Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Domain d2f43a2: 2f43 A:23-94 [145132] Other proteins in same PDB: d2f43a1, d2f43a3, d2f43b1, d2f43b3, d2f43g1 automated match to d1maba2 complexed with adp, atp, mg, vo4 |
PDB Entry: 2f43 (more details), 3 Å
SCOPe Domain Sequences for d2f43a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f43a2 b.49.1.0 (A:23-94) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} vdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndkli kegdivkrtgai
Timeline for d2f43a2:
View in 3D Domains from other chains: (mouse over for more information) d2f43b1, d2f43b2, d2f43b3, d2f43g1 |