Lineage for d2e76b1 (2e76 B:1-160)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239405Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1239406Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 1239407Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1239447Protein Subunit IV of the cytochrome b6f complex [103495] (2 species)
  7. 1239450Species Mastigocladus laminosus [TaxId:83541] [103496] (6 PDB entries)
  8. 1239453Domain d2e76b1: 2e76 B:1-160 [145117]
    Other proteins in same PDB: d2e76a1, d2e76d1, d2e76d2, d2e76e1, d2e76f1, d2e76g1, d2e76h1
    automatically matched to 2E74 B:1-160
    complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq

Details for d2e76b1

PDB Entry: 2e76 (more details), 3.41 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with tridecyl-stigmatellin (TDS) from M.laminosus
PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d2e76b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e76b1 f.32.1.1 (B:1-160) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
mvgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkf
qnpfrrpvattiflfgtlvtiwlgigatfpldktltlglf

SCOPe Domain Coordinates for d2e76b1:

Click to download the PDB-style file with coordinates for d2e76b1.
(The format of our PDB-style files is described here.)

Timeline for d2e76b1: