Class b: All beta proteins [48724] (174 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein ISP subunit from the cytochrome b6f complex, soluble domain [101665] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [101666] (5 PDB entries) |
Domain d2e76d1: 2e76 D:46-179 [132059] Other proteins in same PDB: d2e76a1, d2e76b1, d2e76d2, d2e76e1, d2e76f1, d2e76g1, d2e76h1 automatically matched to d1vf5d1 complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq |
PDB Entry: 2e76 (more details), 3.41 Å
SCOPe Domain Sequences for d2e76d1:
Sequence, based on SEQRES records: (download)
>d2e76d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin avcthlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpw tetdfrtgekpwwv
>d2e76d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} sggavttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdyginavc thlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtet dfrtgekpwwv
Timeline for d2e76d1: