SCOPe 2.08: Domain d2dypd2: 2dyp D:97-195

Lineage for d2dypd2 (2dyp D:97-195)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Ligand binding domain of lir-2 (ilt4) [158879] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158880] (1 PDB entry)
   Uniprot Q8N423 120-218! Uniprot Q8N423 26-109

8. Domain d2dypd2: 2dyp D:97-195 [145109]
   Other proteins in same PDB: d2dypa1, d2dypa2, d2dypb2, d2dypb3

Details for d2dypd2

PDB Entry: 2dyp, 2.5 Å

PDB Description: crystal structure of lilrb2(lir2/ilt4/cd85d) complexed with hla-g

PDB Compounds: (D:) Leukocyte immunoglobulin-like receptor subfamily B member 2

SCOPe Domain Sequences for d2dypd2:

Sequence, based on SEQRES records:

>d2dypd2 b.1.1.4 (D:97-195) Ligand binding domain of lir-2 (ilt4) {Human (Homo sapiens) [TaxId: 9606]}
aypkptlsaqpspvvtsggrvtlqcesqvafggfilckegedehpqclnsqphargssra
ifsvgpvspnrrwshrcygydlnspyvwsspsdllellv

Sequence, based on observed residues (ATOM records):

>d2dypd2 b.1.1.4 (D:97-195) Ligand binding domain of lir-2 (ilt4) {Human (Homo sapiens) [TaxId: 9606]}
aypkptlsaqpspvvtsggrvtlqcesqvafggfilckeehpqclnsqssraifsvgpvs
pnrrwshrcygydlnspyvwsspsdllellv

Timeline for d2dypd2:

• d2dypd2 first appeared in SCOP 1.75
  
• d2dypd2 appears in SCOPe 2.07