Lineage for d2dypa2 (2dyp A:2-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937992Species Human (Homo sapiens), HLA-G [TaxId:9606] [160076] (3 PDB entries)
    Uniprot P17693 25-205! Uniprot P17693 26-205
  8. 2937994Domain d2dypa2: 2dyp A:2-181 [145107]
    Other proteins in same PDB: d2dypa1, d2dypb2, d2dypb3, d2dypd1, d2dypd2

Details for d2dypa2

PDB Entry: 2dyp (more details), 2.5 Å

PDB Description: crystal structure of lilrb2(lir2/ilt4/cd85d) complexed with hla-g
PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain G

SCOPe Domain Sequences for d2dypa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dypa2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-G [TaxId: 9606]}
shsmryfsaavsrpgrgeprfiamgyvddtqfvrfdsdsasprmeprapwveqegpeywe
eetrntkahaqtdrmnlqtlrgyynqseasshtlqwmigcdlgsdgrllrgyeqyaydgk
dylalnedlrswtaadtaaqiskrkceaanvaeqrraylegtcvewlhrylengkemlqr

SCOPe Domain Coordinates for d2dypa2:

Click to download the PDB-style file with coordinates for d2dypa2.
(The format of our PDB-style files is described here.)

Timeline for d2dypa2: