Lineage for d2dspb1 (2dsp B:1-92)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635726Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 2635727Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins)
    Pfam PF00757; Pfam PF14843; Pfam PF15913
  6. 2635751Protein Insulin-like growth factor-binding protein 4, IGFBP4 [161124] (1 species)
  7. 2635752Species Human (Homo sapiens) [TaxId:9606] [161125] (1 PDB entry)
    Uniprot P22692 22-113
  8. 2635753Domain d2dspb1: 2dsp B:1-92 [145088]
    Other proteins in same PDB: d2dspi_

Details for d2dspb1

PDB Entry: 2dsp (more details), 2.5 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (B:) Insulin-like growth factor-binding protein 4

SCOPe Domain Sequences for d2dspb1:

Sequence, based on SEQRES records: (download)

>d2dspb1 g.3.9.1 (B:1-92) Insulin-like growth factor-binding protein 4, IGFBP4 {Human (Homo sapiens) [TaxId: 9606]}
deaihcppcseeklarcrppvgceelvrepgcgccatcalglgmpcgvytprcgsglrcy
pprgvekplhtlmhgqgvcmelaeieaiqesl

Sequence, based on observed residues (ATOM records): (download)

>d2dspb1 g.3.9.1 (B:1-92) Insulin-like growth factor-binding protein 4, IGFBP4 {Human (Homo sapiens) [TaxId: 9606]}
deaihcppcseeklarcrppvgceelvrepgcgccatcalglgmpcgvytprcgsglrcy
ppgvekplhtlmhgqgvcmelaeieaiqesl

SCOPe Domain Coordinates for d2dspb1:

Click to download the PDB-style file with coordinates for d2dspb1.
(The format of our PDB-style files is described here.)

Timeline for d2dspb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dspi_