SCOPe 2.08: Domain d2dspb1: 2dsp B:1-92

Lineage for d2dspb1 (2dsp B:1-92)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins)
   Pfam PF00757; Pfam PF14843; Pfam PF15913
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures
   

6. Protein Insulin-like growth factor-binding protein 4, IGFBP4 [161124] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161125] (1 PDB entry)
   Uniprot P22692 22-113

8. Domain d2dspb1: 2dsp B:1-92 [145088]
   Other proteins in same PDB: d2dspi_

Details for d2dspb1

PDB Entry: 2dsp, 2.5 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins

PDB Compounds: (B:) Insulin-like growth factor-binding protein 4

SCOPe Domain Sequences for d2dspb1:

Sequence, based on SEQRES records:

>d2dspb1 g.3.9.1 (B:1-92) Insulin-like growth factor-binding protein 4, IGFBP4 {Human (Homo sapiens) [TaxId: 9606]}
deaihcppcseeklarcrppvgceelvrepgcgccatcalglgmpcgvytprcgsglrcy
pprgvekplhtlmhgqgvcmelaeieaiqesl

Sequence, based on observed residues (ATOM records):

>d2dspb1 g.3.9.1 (B:1-92) Insulin-like growth factor-binding protein 4, IGFBP4 {Human (Homo sapiens) [TaxId: 9606]}
deaihcppcseeklarcrppvgceelvrepgcgccatcalglgmpcgvytprcgsglrcy
ppgvekplhtlmhgqgvcmelaeieaiqesl

Timeline for d2dspb1:

• d2dspb1 first appeared in SCOP 1.75
  
• d2dspb1 appears in SCOPe 2.07