Lineage for d2buxa1 (2bux A:4-200)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (6 PDB entries)
  8. Domain d2buxa1: 2bux A:4-200 [145017]
    Other proteins in same PDB: d2buxb_
    complexed with fe, oh; mutant

Details for d2buxa1

PDB Entry: 2bux (more details), 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d2buxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buxa1 b.3.6.1 (A:4-200) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifahginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

SCOPe Domain Coordinates for d2buxa1 are not available.

Timeline for d2buxa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2buxb_