Lineage for d2buxa1 (2bux A:4-200)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790808Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 790809Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 790824Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 790825Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (16 PDB entries)
  8. 790830Domain d2buxa1: 2bux A:4-200 [145017]
    Other proteins in same PDB: d2buxb1
    complexed with fe, hyd; mutant

Details for d2buxa1

PDB Entry: 2bux (more details), 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOP Domain Sequences for d2buxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buxa1 b.3.6.1 (A:4-200) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifahginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

SCOP Domain Coordinates for d2buxa1:

Click to download the PDB-style file with coordinates for d2buxa1.
(The format of our PDB-style files is described here.)

Timeline for d2buxa1: