![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
![]() | Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
![]() | Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
![]() | Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (13 PDB entries) |
![]() | Domain d2buxb_: 2bux B: [129233] Other proteins in same PDB: d2buxa1 automated match to d1eo2b_ complexed with fe, oh; mutant |
PDB Entry: 2bux (more details), 1.8 Å
SCOPe Domain Sequences for d2buxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2buxb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]} iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt
Timeline for d2buxb_: