![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.10: EspE N-terminal domain-like [160246] (1 family) ![]() contains extra C-terminal helix that packs against shorter N-terminal helix |
![]() | Family d.52.10.1: GSPII protein E N-terminal domain-like [160247] (3 proteins) Pfam PF05157 (also includes PfamB PB000210) |
![]() | Protein General secretion pathway protein E, EpsE [160250] (1 species) |
![]() | Species Vibrio cholerae [TaxId:666] [160251] (1 PDB entry) Uniprot P37093 14-81 |
![]() | Domain d2bh1x1: 2bh1 X:14-81 [144990] Other proteins in same PDB: d2bh1a1, d2bh1a2, d2bh1b1, d2bh1b2, d2bh1y_ complexed with ca |
PDB Entry: 2bh1 (more details), 2.4 Å
SCOPe Domain Sequences for d2bh1x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bh1x1 d.52.10.1 (X:14-81) General secretion pathway protein E, EpsE {Vibrio cholerae [TaxId: 666]} irrlpfsfanrfklvldwnedfsqasiyylaplsmealvetkrvvkhafqlielsqaefe skltqvyq
Timeline for d2bh1x1: