SCOPe 2.04: Domain d2bh1b1: 2bh1 B:146-239

Lineage for d2bh1b1 (2bh1 B:146-239)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [255053] (1 PDB entry)

8. Domain d2bh1b1: 2bh1 B:146-239 [128508]
   Other proteins in same PDB: d2bh1a2, d2bh1b2, d2bh1x1, d2bh1y_
   automated match to d2bh1b1
   complexed with ca

Details for d2bh1b1

PDB Entry: 2bh1, 2.4 Å

PDB Description: x-ray structure of the general secretion pathway complex of the n-terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae

PDB Compounds: (B:) general secretion pathway protein l

SCOPe Domain Sequences for d2bh1b1:

Sequence; same for both SEQRES and ATOM records:

>d2bh1b1 c.55.1.0 (B:146-239) automated matches {Vibrio cholerae [TaxId: 666]}
ehglaalqlgdewlvrksttqgmavdaqwlsllaasdwvqnegeylplqaltplpelsla
etqewryepsglvmqlltqealtskfnlltgsfk

Timeline for d2bh1b1:

• d2bh1b1 first appeared in SCOP 1.73
  
• d2bh1b1 appears in SCOPe 2.03
  
• d2bh1b1 appears in SCOPe 2.05
  
• d2bh1b1 appears in the current release, SCOPe 2.08