Lineage for d2axtk1 (2axt K:10-46)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958520Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (1 family) (S)
    automatically mapped to Pfam PF02533
  5. 1958521Family f.23.36.1: PsbK-like [161038] (1 protein)
    Pfam PF02533
  6. 1958522Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 1958523Species Thermosynechococcus elongatus [TaxId:146786] [161040] (3 PDB entries)
    Uniprot Q9F1K9 10-46
  8. 1958524Domain d2axtk1: 2axt K:10-46 [144935]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtk1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d2axtk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtk1 f.23.36.1 (K:10-46) Photosystem II reaction center protein K, PsbK {Thermosynechococcus elongatus [TaxId: 146786]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d2axtk1:

Click to download the PDB-style file with coordinates for d2axtk1.
(The format of our PDB-style files is described here.)

Timeline for d2axtk1: