Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
Superfamily f.4.1: OMPA-like [56925] (5 families) forms (8,10) barrel |
Family f.4.1.4: PsbO-like [161115] (2 proteins) Pfam PF01716; MSP |
Protein Manganese-stabilising protein, PsbO [161116] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161117] (1 PDB entry) Uniprot P0A431 30-271 |
Domain d2axto1: 2axt O:30-271 [144938] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axtt1, d2axtu1, d2axtv_, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk |
PDB Entry: 2axt (more details), 3 Å
SCOPe Domain Sequences for d2axto1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axto1 f.4.1.4 (O:30-271) Manganese-stabilising protein, PsbO {Thermosynechococcus elongatus [TaxId: 146786]} tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi ep
Timeline for d2axto1: