Lineage for d2axto1 (2axt O:30-271)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955624Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 1955625Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 1955660Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 1955661Protein Manganese-stabilising protein, PsbO [161116] (2 species)
  7. 1955662Species Thermosynechococcus elongatus [TaxId:146786] [161117] (1 PDB entry)
    Uniprot P0A431 30-271
  8. 1955663Domain d2axto1: 2axt O:30-271 [144938]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axtt1, d2axtu1, d2axtv_, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axto1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d2axto1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axto1 f.4.1.4 (O:30-271) Manganese-stabilising protein, PsbO {Thermosynechococcus elongatus [TaxId: 146786]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
ep

SCOPe Domain Coordinates for d2axto1:

Click to download the PDB-style file with coordinates for d2axto1.
(The format of our PDB-style files is described here.)

Timeline for d2axto1: