Lineage for d2aa1d_ (2aa1 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300465Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300470Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (7 PDB entries)
  8. 2300473Domain d2aa1d_: 2aa1 D: [144794]
    Other proteins in same PDB: d2aa1a_, d2aa1c_
    automated match to d2aa1b1
    complexed with hem

Details for d2aa1d_

PDB Entry: 2aa1 (more details), 1.8 Å

PDB Description: Crystal structure of the cathodic hemoglobin isolated from the Antarctic fish Trematomus Newnesi
PDB Compounds: (D:) Hemoglobin beta-C chain

SCOPe Domain Sequences for d2aa1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aa1d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdferatikdifskleydvvgpatlarclvvypwtqryfgkfgnlynaaaiaqnamv
skhgttilngldravknmdditntyaelsvlhseklhvdpdnfklladcltivvaarfgs
aftgevqaafqkfmavvvsslgkqyr

SCOPe Domain Coordinates for d2aa1d_:

Click to download the PDB-style file with coordinates for d2aa1d_.
(The format of our PDB-style files is described here.)

Timeline for d2aa1d_: