SCOPe 2.07: Domain d2aa1d_: 2aa1 D:

Lineage for d2aa1d_ (2aa1 D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (7 PDB entries)

8. Domain d2aa1d_: 2aa1 D: [144794]
   Other proteins in same PDB: d2aa1a_, d2aa1c_
   automated match to d2aa1b1
   complexed with hem

Details for d2aa1d_

PDB Entry: 2aa1, 1.8 Å

PDB Description: Crystal structure of the cathodic hemoglobin isolated from the Antarctic fish Trematomus Newnesi

PDB Compounds: (D:) Hemoglobin beta-C chain

SCOPe Domain Sequences for d2aa1d_:

Sequence; same for both SEQRES and ATOM records:

>d2aa1d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdferatikdifskleydvvgpatlarclvvypwtqryfgkfgnlynaaaiaqnamv
skhgttilngldravknmdditntyaelsvlhseklhvdpdnfklladcltivvaarfgs
aftgevqaafqkfmavvvsslgkqyr

Timeline for d2aa1d_:

• d2aa1d_ first appeared in SCOP 1.75, called d2aa1d1
  
• d2aa1d_ appears in SCOPe 2.06
  
• d2aa1d_ appears in the current release, SCOPe 2.08