![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (7 PDB entries) |
![]() | Domain d2aa1b1: 2aa1 B:1-146 [144793] Other proteins in same PDB: d2aa1a_, d2aa1c_ complexed with hem |
PDB Entry: 2aa1 (more details), 1.8 Å
SCOPe Domain Sequences for d2aa1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aa1b1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} vewtdferatikdifskleydvvgpatlarclvvypwtqryfgkfgnlynaaaiaqnamv skhgttilngldravknmdditntyaelsvlhseklhvdpdnfklladcltivvaarfgs aftgevqaafqkfmavvvsslgkqyr
Timeline for d2aa1b1: