| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) ![]() Pfam PF00520 |
| Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
| Protein Potassium channel protein [56901] (3 species) |
| Species Streptomyces lividans [TaxId:1916] [161074] (28 PDB entries) |
| Domain d2a9hc_: 2a9h C: [144791] Other proteins in same PDB: d2a9he1 automated match to d1r3jc_ |
PDB Entry: 2a9h (more details)
SCOPe Domain Sequences for d2a9hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9hc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly
pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq
Timeline for d2a9hc_:
View in 3DDomains from other chains: (mouse over for more information) d2a9ha1, d2a9hb_, d2a9hd_, d2a9he1 |