![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries) Uniprot P01901 22-299 |
![]() | Domain d1zs8i1: 1zs8 I:181-274 [144757] Other proteins in same PDB: d1zs8a2, d1zs8b_, d1zs8c2, d1zs8d_, d1zs8e2, d1zs8f_, d1zs8g2, d1zs8h_, d1zs8i2, d1zs8j_ automated match to d1zs8a1 complexed with nag |
PDB Entry: 1zs8 (more details), 3 Å
SCOPe Domain Sequences for d1zs8i1:
Sequence, based on SEQRES records: (download)
>d1zs8i1 b.1.1.2 (I:181-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} sdaprthvthkvtpegnvtlrcwalgfypaditltwkrdgknhtqdmelpdtrpagdgtf qkwaavvvpfgeelrytchvhheglpgpltlkwg
>d1zs8i1 b.1.1.2 (I:181-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} sdaprthvthkvtvtlrcwalgfypaditltwkrdgknhtqdmelpdtrpagdgtfqkwa avvvpfgeelrytchvhheglpgpltlkwg
Timeline for d1zs8i1: