SCOP 1.75: Domain d1zs8i1: 1zs8 I:181-274

Lineage for d1zs8i1 (1zs8 I:181-274)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
   Uniprot P01901 22-299

8. Domain d1zs8i1: 1zs8 I:181-274 [144757]
   Other proteins in same PDB: d1zs8a2, d1zs8b1, d1zs8c2, d1zs8d1, d1zs8e2, d1zs8f1, d1zs8g2, d1zs8h1, d1zs8i2, d1zs8j1
   automatically matched to 1ZS8 A:181-274
   complexed with nag

Details for d1zs8i1

PDB Entry: 1zs8, 3 Å

PDB Description: crystal structure of the murine mhc class ib molecule m10.5

PDB Compounds: (I:) histocompatibility 2, M region locus 10.5

SCOP Domain Sequences for d1zs8i1:

Sequence, based on SEQRES records:

>d1zs8i1 b.1.1.2 (I:181-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
sdaprthvthkvtpegnvtlrcwalgfypaditltwkrdgknhtqdmelpdtrpagdgtf
qkwaavvvpfgeelrytchvhheglpgpltlkwg

Sequence, based on observed residues (ATOM records):

>d1zs8i1 b.1.1.2 (I:181-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
sdaprthvthkvtvtlrcwalgfypaditltwkrdgknhtqdmelpdtrpagdgtfqkwa
avvvpfgeelrytchvhheglpgpltlkwg

Timeline for d1zs8i1:

• d1zs8i1 is new in SCOP 1.75
  
• d1zs8i1 appears in SCOPe 2.01
  
• d1zs8i1 appears in the current release, SCOPe 2.08