Lineage for d1zs8e2 (1zs8 E:1-180)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938201Species Mouse (Mus musculus), H-2M10 [TaxId:10090] [160077] (2 PDB entries)
  8. 2938205Domain d1zs8e2: 1zs8 E:1-180 [144754]
    Other proteins in same PDB: d1zs8a1, d1zs8b_, d1zs8c1, d1zs8d_, d1zs8e1, d1zs8f_, d1zs8g1, d1zs8h_, d1zs8i1, d1zs8j_
    automated match to d1zs8a2
    complexed with nag

Details for d1zs8e2

PDB Entry: 1zs8 (more details), 3 Å

PDB Description: crystal structure of the murine mhc class ib molecule m10.5
PDB Compounds: (E:) histocompatibility 2, M region locus 10.5

SCOPe Domain Sequences for d1zs8e2:

Sequence, based on SEQRES records: (download)

>d1zs8e2 d.19.1.1 (E:1-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2M10 [TaxId: 10090]}
shwlktfrivimepgileprfiqvsyvdsiqyqgfdsrsetagmqpraawmkqeppeywk
netehamgasllarrtliymvtennnkkndyhtlqevfgcnvahdgsflgghygltyygy
dyiilnedlnswttegkvggkfnpdrtqgsvtegwrtylkgecterflrcldlgketllr

Sequence, based on observed residues (ATOM records): (download)

>d1zs8e2 d.19.1.1 (E:1-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2M10 [TaxId: 10090]}
shwlktfrivimepgileprfiqvsyvdsiqyqgfdsrsgmqpraawmkqeppeywknet
ehamgasllarrtliymvtennnkkndyhtlqevfgcnvahdgsflgghygltyygydyi
ilnedlnswttegkvggkfnsvtegwrtylkgecterflrcldlgketllr

SCOPe Domain Coordinates for d1zs8e2:

Click to download the PDB-style file with coordinates for d1zs8e2.
(The format of our PDB-style files is described here.)

Timeline for d1zs8e2: