Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) |
Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
Species Pseudomonas putida [TaxId:303] [49490] (31 PDB entries) |
Domain d1ykmj_: 1ykm J: [144670] Other proteins in same PDB: d1ykma_, d1ykmc_, d1ykme_, d1ykmg_, d1ykmi_, d1ykmk_ automated match to d1ykmb1 complexed with fe; mutant |
PDB Entry: 1ykm (more details), 2.22 Å
SCOPe Domain Sequences for d1ykmj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykmj_ b.3.6.1 (J:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]} paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrerhkndrylapld pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
Timeline for d1ykmj_: