Lineage for d1ykmb1 (1ykm B:301-538)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113967Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 1113968Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1114150Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 1114165Species Pseudomonas putida [TaxId:303] [49490] (31 PDB entries)
  8. 1114229Domain d1ykmb1: 1ykm B:301-538 [144666]
    Other proteins in same PDB: d1ykma_, d1ykmc_, d1ykme_, d1ykmg_, d1ykmi_, d1ykmk_
    complexed with fe; mutant

Details for d1ykmb1

PDB Entry: 1ykm (more details), 2.22 Å

PDB Description: protocatechuate 3,4-dioxygenase y408e mutant
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d1ykmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykmb1 b.3.6.1 (B:301-538) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrerhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d1ykmb1:

Click to download the PDB-style file with coordinates for d1ykmb1.
(The format of our PDB-style files is described here.)

Timeline for d1ykmb1: