SCOPe 2.08: Domain d1y4zb1: 1y4z B:1-509

Lineage for d1y4zb1 (1y4z B:1-509)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species)

7. Species Escherichia coli [TaxId:562] [102956] (8 PDB entries)
   Uniprot P11349

8. Domain d1y4zb1: 1y4z B:1-509 [144594]
   Other proteins in same PDB: d1y4za1, d1y4za2, d1y4zc_
   complexed with 6mo, aga, f3s, hem, md1, pci, sf4

Details for d1y4zb1

PDB Entry: 1y4z, 2 Å

PDB Description: the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol

PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOPe Domain Sequences for d1y4zb1:

Sequence; same for both SEQRES and ATOM records:

>d1y4zb1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtaknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte

Timeline for d1y4zb1:

• d1y4zb1 first appeared in SCOP 1.75
  
• d1y4zb1 appears in SCOPe 2.07