Lineage for d1y4zb1 (1y4z B:1-509)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861004Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 861105Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 861204Protein Respiratory nitrate reductase 1 beta chain [102955] (1 species)
  7. 861205Species Escherichia coli [TaxId:562] [102956] (7 PDB entries)
    Uniprot P11349
  8. 861210Domain d1y4zb1: 1y4z B:1-509 [144594]
    Other proteins in same PDB: d1y4za1, d1y4za2, d1y4zc1
    complexed with 6mo, aga, f3s, hem, md1, pci, sf4; mutant

Details for d1y4zb1

PDB Entry: 1y4z (more details), 2 Å

PDB Description: the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol
PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOP Domain Sequences for d1y4zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4zb1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtaknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte

SCOP Domain Coordinates for d1y4zb1:

Click to download the PDB-style file with coordinates for d1y4zb1.
(The format of our PDB-style files is described here.)

Timeline for d1y4zb1: