SCOPe 2.03: Domain d1wpxb1: 1wpx B:501-719

Lineage for d1wpxb1 (1wpx B:501-719)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)

6. Protein Carboxypeptidase Y inhibitor [158954] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158955] (1 PDB entry)
   Uniprot P14306 1-219

8. Domain d1wpxb1: 1wpx B:501-719 [144559]
   Other proteins in same PDB: d1wpxa_
   complexed with nag, ndg, so4

Details for d1wpxb1

PDB Entry: 1wpx, 2.7 Å

PDB Description: crystal structure of carboxypeptidase y inhibitor complexed with the cognate proteinase

PDB Compounds: (B:) Carboxypeptidase Y inhibitor

SCOPe Domain Sequences for d1wpxb1:

Sequence, based on SEQRES records:

>d1wpxb1 b.17.1.1 (B:501-719) Carboxypeptidase Y inhibitor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnqaidfaqasidsykkhgiledvihdtsfqpsgilaveysssapvamgntlptekarsk
pqfqftfnkqmqksvpqanayvpqdddlftlvmtdpdapsktdhkwsefchlvecdlkll
neathetsgateffasefntkgsntlieymgpappkgsgphryvfllykqpkgvdsskfs
kikdrpnwgygtpatgvgkwakennlqlvasnffyaetk

Sequence, based on observed residues (ATOM records):

>d1wpxb1 b.17.1.1 (B:501-719) Carboxypeptidase Y inhibitor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnqaidfaqasidsykkhgiledvihdtsfqpsgilaveysssapvamgntlptekarsk
pqfqftfnkqmqnayvpqdddlftlvmtdpdapsktdhkwsefchlvecdlkllnteffa
sefntkgsntlieymgpappkgsgphryvfllykqpkgvdsskfskikdrpnwgygtpat
gvgkwakennlqlvasnffyaetk

Timeline for d1wpxb1:

• d1wpxb1 first appeared in SCOP 1.75
  
• d1wpxb1 appears in SCOPe 2.02
  
• d1wpxb1 appears in SCOPe 2.04
  
• d1wpxb1 appears in the current release, SCOPe 2.08