![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.17.1: PEBP-like [49777] (3 families) ![]() |
![]() | Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins) |
![]() | Protein Carboxypeptidase Y inhibitor [158954] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158955] (1 PDB entry) Uniprot P14306 1-219 |
![]() | Domain d1wpxb1: 1wpx B:501-719 [144559] Other proteins in same PDB: d1wpxa_ complexed with nag, ndg, so4 |
PDB Entry: 1wpx (more details), 2.7 Å
SCOPe Domain Sequences for d1wpxb1:
Sequence, based on SEQRES records: (download)
>d1wpxb1 b.17.1.1 (B:501-719) Carboxypeptidase Y inhibitor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mnqaidfaqasidsykkhgiledvihdtsfqpsgilaveysssapvamgntlptekarsk pqfqftfnkqmqksvpqanayvpqdddlftlvmtdpdapsktdhkwsefchlvecdlkll neathetsgateffasefntkgsntlieymgpappkgsgphryvfllykqpkgvdsskfs kikdrpnwgygtpatgvgkwakennlqlvasnffyaetk
>d1wpxb1 b.17.1.1 (B:501-719) Carboxypeptidase Y inhibitor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mnqaidfaqasidsykkhgiledvihdtsfqpsgilaveysssapvamgntlptekarsk pqfqftfnkqmqnayvpqdddlftlvmtdpdapsktdhkwsefchlvecdlkllnteffa sefntkgsntlieymgpappkgsgphryvfllykqpkgvdsskfskikdrpnwgygtpat gvgkwakennlqlvasnffyaetk
Timeline for d1wpxb1: