Lineage for d1wpxb1 (1wpx B:501-719)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792767Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 792768Superfamily b.17.1: PEBP-like [49777] (2 families) (S)
  5. 792769Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (3 proteins)
  6. 792770Protein Carboxypeptidase Y inhibitor [158954] (1 species)
  7. 792771Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158955] (1 PDB entry)
    Uniprot P14306 1-219
  8. 792772Domain d1wpxb1: 1wpx B:501-719 [144559]
    Other proteins in same PDB: d1wpxa1
    complexed with ace, nag, ndg, so4

Details for d1wpxb1

PDB Entry: 1wpx (more details), 2.7 Å

PDB Description: crystal structure of carboxypeptidase y inhibitor complexed with the cognate proteinase
PDB Compounds: (B:) Carboxypeptidase Y inhibitor

SCOP Domain Sequences for d1wpxb1:

Sequence, based on SEQRES records: (download)

>d1wpxb1 b.17.1.1 (B:501-719) Carboxypeptidase Y inhibitor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnqaidfaqasidsykkhgiledvihdtsfqpsgilaveysssapvamgntlptekarsk
pqfqftfnkqmqksvpqanayvpqdddlftlvmtdpdapsktdhkwsefchlvecdlkll
neathetsgateffasefntkgsntlieymgpappkgsgphryvfllykqpkgvdsskfs
kikdrpnwgygtpatgvgkwakennlqlvasnffyaetk

Sequence, based on observed residues (ATOM records): (download)

>d1wpxb1 b.17.1.1 (B:501-719) Carboxypeptidase Y inhibitor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnqaidfaqasidsykkhgiledvihdtsfqpsgilaveysssapvamgntlptekarsk
pqfqftfnkqmqnayvpqdddlftlvmtdpdapsktdhkwsefchlvecdlkllnteffa
sefntkgsntlieymgpappkgsgphryvfllykqpkgvdsskfskikdrpnwgygtpat
gvgkwakennlqlvasnffyaetk

SCOP Domain Coordinates for d1wpxb1:

Click to download the PDB-style file with coordinates for d1wpxb1.
(The format of our PDB-style files is described here.)

Timeline for d1wpxb1: