Lineage for d1wpxb1 (1wpx B:501-719)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774037Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2774038Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2774039Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)
  6. 2774040Protein Carboxypeptidase Y inhibitor [158954] (1 species)
  7. 2774041Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158955] (1 PDB entry)
    Uniprot P14306 1-219
  8. 2774042Domain d1wpxb1: 1wpx B:501-719 [144559]
    Other proteins in same PDB: d1wpxa_
    complexed with nag, so4

Details for d1wpxb1

PDB Entry: 1wpx (more details), 2.7 Å

PDB Description: crystal structure of carboxypeptidase y inhibitor complexed with the cognate proteinase
PDB Compounds: (B:) Carboxypeptidase Y inhibitor

SCOPe Domain Sequences for d1wpxb1:

Sequence, based on SEQRES records: (download)

>d1wpxb1 b.17.1.1 (B:501-719) Carboxypeptidase Y inhibitor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnqaidfaqasidsykkhgiledvihdtsfqpsgilaveysssapvamgntlptekarsk
pqfqftfnkqmqksvpqanayvpqdddlftlvmtdpdapsktdhkwsefchlvecdlkll
neathetsgateffasefntkgsntlieymgpappkgsgphryvfllykqpkgvdsskfs
kikdrpnwgygtpatgvgkwakennlqlvasnffyaetk

Sequence, based on observed residues (ATOM records): (download)

>d1wpxb1 b.17.1.1 (B:501-719) Carboxypeptidase Y inhibitor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnqaidfaqasidsykkhgiledvihdtsfqpsgilaveysssapvamgntlptekarsk
pqfqftfnkqmqnayvpqdddlftlvmtdpdapsktdhkwsefchlvecdlkllnteffa
sefntkgsntlieymgpappkgsgphryvfllykqpkgvdsskfskikdrpnwgygtpat
gvgkwakennlqlvasnffyaetk

SCOPe Domain Coordinates for d1wpxb1:

Click to download the PDB-style file with coordinates for d1wpxb1.
(The format of our PDB-style files is described here.)

Timeline for d1wpxb1: