SCOPe 2.08: Domain d1vsaa1: 1vsa A:6-229

Lineage for d1vsaa1 (1vsa A:6-229)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
   2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)

4. Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family)
   automatically mapped to Pfam PF00687

5. Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)

6. Protein Ribosomal protein L1 [56810] (4 species)

7. Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)

8. Domain d1vsaa1: 1vsa A:6-229 [144517]
   Other proteins in same PDB: d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
   protein/RNA complex
   protein/RNA complex
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1vsaa1

PDB Entry: 1vsa, 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8

PDB Compounds: (A:) 50s ribosomal protein l1

SCOPe Domain Sequences for d1vsaa1:

Sequence, based on SEQRES records:

>d1vsaa1 e.24.1.1 (A:6-229) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl
phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg
sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek
ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

Sequence, based on observed residues (ATOM records):

>d1vsaa1 e.24.1.1 (A:6-229) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsi
efrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvyvtttmgps
vrinphs

Timeline for d1vsaa1:

• d1vsaa1 first appeared in SCOP 1.75
  
• d1vsaa1 appears in SCOPe 2.07