![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
![]() | Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries) Uniprot Q72I15 2-102 |
![]() | Domain d1vsas1: 1vsa S:2-102 [144530] Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1 protein/RNA complex protein/RNA complex |
PDB Entry: 1vsa (more details), 3.71 Å
SCOPe Domain Sequences for d1vsas1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsas1 b.34.5.1 (S:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakc
Timeline for d1vsas1: