SCOPe 2.08: Domain d1vq621: 1vq6 2:1-49

Lineage for d1vq621 (1vq6 2:1-49)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix
   automatically mapped to Pfam PF00832

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
   Uniprot P22452

8. Domain d1vq621: 1vq6 2:1-49 [144413]
   Other proteins in same PDB: d1vq611, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1
   automatically matched to 1VQ4 2:1-49
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq621

PDB Entry: 1vq6, 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d1vq621:

Sequence, based on SEQRES records:

>d1vq621 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d1vq621 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

Timeline for d1vq621:

• d1vq621 first appeared in SCOP 1.75
  
• d1vq621 appears in SCOPe 2.07