SCOPe 2.08: Domain d1vq6y1: 1vq6 Y:95-236

Lineage for d1vq6y1 (1vq6 Y:95-236)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
   Uniprot P12736

8. Domain d1vq6y1: 1vq6 Y:95-236 [120154]
   Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6z1
   automatically matched to d1jj2x_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq6y1

PDB Entry: 1vq6, 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d1vq6y1:

Sequence; same for both SEQRES and ATOM records:

>d1vq6y1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d1vq6y1:

• d1vq6y1 first appeared in SCOP 1.73
  
• d1vq6y1 appears in SCOPe 2.07