Lineage for d1rjca1 (1rjc A:2-127)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352475Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 2352476Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 2352477Domain d1rjca1: 1rjc A:2-127 [144370]
    Other proteins in same PDB: d1rjcb_
    complexed with gol, po4

Details for d1rjca1

PDB Entry: 1rjc (more details), 1.4 Å

PDB Description: Crystal structure of the camelid single domain antibody cAb-Lys2 in complex with hen egg white lysozyme
PDB Compounds: (A:) camelid heavy chain antibody

SCOPe Domain Sequences for d1rjca1:

Sequence, based on SEQRES records: (download)

>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlqasgggsvqagqslrlscatsgatsssncmgwfrqapgkeregvavidtgrgntaya
dsvqgrltisldnakntlylqmnslkpedtamyycaadtstwyrgycgtnpnyfsywgqg
tqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlqasgggsvqagqslrlscatsatsssncmgwfrqapgkeregvavidtgrgntayad
svqgrltisldnntlylqmnslkpedtamyycaadtstwyrgycgtnpnyfsywgqgtqv
tvs

SCOPe Domain Coordinates for d1rjca1:

Click to download the PDB-style file with coordinates for d1rjca1.
(The format of our PDB-style files is described here.)

Timeline for d1rjca1: