SCOPe 2.08: Domain d1rjca1: 1rjc A:2-127

Lineage for d1rjca1 (1rjc A:2-127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
   SQ NA # camelid antibody

8. Domain d1rjca1: 1rjc A:2-127 [144370]
   Other proteins in same PDB: d1rjcb_
   complexed with gol, po4

Details for d1rjca1

PDB Entry: 1rjc, 1.4 Å

PDB Description: Crystal structure of the camelid single domain antibody cAb-Lys2 in complex with hen egg white lysozyme

PDB Compounds: (A:) camelid heavy chain antibody

SCOPe Domain Sequences for d1rjca1:

Sequence, based on SEQRES records:

>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlqasgggsvqagqslrlscatsgatsssncmgwfrqapgkeregvavidtgrgntaya
dsvqgrltisldnakntlylqmnslkpedtamyycaadtstwyrgycgtnpnyfsywgqg
tqvtvs

Sequence, based on observed residues (ATOM records):

>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlqasgggsvqagqslrlscatsatsssncmgwfrqapgkeregvavidtgrgntayad
svqgrltisldnntlylqmnslkpedtamyycaadtstwyrgycgtnpnyfsywgqgtqv
tvs

Timeline for d1rjca1:

• d1rjca1 first appeared in SCOP 1.75
  
• d1rjca1 appears in SCOPe 2.07