SCOPe 2.08: Domain d2ysub1: 2ysu B:323-438

Lineage for d2ysub1 (2ysu B:323-438)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.9: Colicin E3 receptor domain [69985] (1 family)

5. Family h.4.9.1: Colicin E3 receptor domain [69986] (1 protein)

6. Protein Colicin E3 receptor domain [69987] (1 species)

7. Species Escherichia coli [TaxId:562] [69988] (4 PDB entries)

8. Domain d2ysub1: 2ysu B:323-438 [140063]
   Other proteins in same PDB: d2ysua1
   automatically matched to d1ujwb_

Details for d2ysub1

PDB Entry: 2ysu, 3.5 Å

PDB Description: Structure of the complex between BtuB and Colicin E2 receptor binding domain

PDB Compounds: (B:) Colicin-E2

SCOPe Domain Sequences for d2ysub1:

Sequence; same for both SEQRES and ATOM records:

>d2ysub1 h.4.9.1 (B:323-438) Colicin E3 receptor domain {Escherichia coli [TaxId: 562]}
yeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqfnrfahdp
magghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalsaaqerrkqkenk

Timeline for d2ysub1:

• d2ysub1 first appeared in SCOP 1.73
  
• d2ysub1 appears in SCOPe 2.07