![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
![]() | Superfamily h.4.9: Colicin E3 receptor domain [69985] (1 family) ![]() |
![]() | Family h.4.9.1: Colicin E3 receptor domain [69986] (1 protein) |
![]() | Protein Colicin E3 receptor domain [69987] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69988] (4 PDB entries) |
![]() | Domain d2ysub1: 2ysu B:323-438 [140063] Other proteins in same PDB: d2ysua1 automatically matched to d1ujwb_ |
PDB Entry: 2ysu (more details), 3.5 Å
SCOPe Domain Sequences for d2ysub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ysub1 h.4.9.1 (B:323-438) Colicin E3 receptor domain {Escherichia coli [TaxId: 562]} yeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqfnrfahdp magghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalsaaqerrkqkenk
Timeline for d2ysub1: