Lineage for d2ysub1 (2ysu B:323-438)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2646825Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2646930Superfamily h.4.9: Colicin E3 receptor domain [69985] (1 family) (S)
  5. 2646931Family h.4.9.1: Colicin E3 receptor domain [69986] (1 protein)
  6. 2646932Protein Colicin E3 receptor domain [69987] (1 species)
  7. 2646933Species Escherichia coli [TaxId:562] [69988] (4 PDB entries)
  8. 2646937Domain d2ysub1: 2ysu B:323-438 [140063]
    Other proteins in same PDB: d2ysua1
    automatically matched to d1ujwb_

Details for d2ysub1

PDB Entry: 2ysu (more details), 3.5 Å

PDB Description: Structure of the complex between BtuB and Colicin E2 receptor binding domain
PDB Compounds: (B:) Colicin-E2

SCOPe Domain Sequences for d2ysub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ysub1 h.4.9.1 (B:323-438) Colicin E3 receptor domain {Escherichia coli [TaxId: 562]}
yeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqfnrfahdp
magghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalsaaqerrkqkenk

SCOPe Domain Coordinates for d2ysub1:

Click to download the PDB-style file with coordinates for d2ysub1.
(The format of our PDB-style files is described here.)

Timeline for d2ysub1: