SCOPe 2.08: Domain d2uvva1: 2uvv A:241-343

Lineage for d2uvva1 (2uvv A:241-343)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.0: automated matches [231323] (1 protein)
   not a true family

6. Protein automated matches [231324] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries)

8. Domain d2uvva1: 2uvv A:241-343 [139984]
   Other proteins in same PDB: d2uvva2
   automated match to d1jx4a1
   complexed with ca, dgt; mutant

Details for d2uvva1

PDB Entry: 2uvv, 2.2 Å

PDB Description: crystal structures of mutant dpo4 dna polymerases with 8-oxog containing dna template-primer constructs

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2uvva1:

Sequence; same for both SEQRES and ATOM records:

>d2uvva1 d.240.1.0 (A:241-343) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkireigvrfskfiea

Timeline for d2uvva1:

• d2uvva1 first appeared in SCOP 1.73
  
• d2uvva1 appears in SCOPe 2.07