SCOP 1.73: Domain d2uvva1: 2uvv A:241-342

Lineage for d2uvva1 (2uvv A:241-342)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (2 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (41 PDB entries)

8. Domain d2uvva1: 2uvv A:241-342 [139984]
   Other proteins in same PDB: d2uvva2
   automatically matched to d1n48a1
   complexed with 8og, ca, dgt; mutant

Details for d2uvva1

PDB Entry: 2uvv, 2.2 Å

PDB Description: crystal structures of mutant dpo4 dna polymerases with 8-oxog containing dna template-primer constructs

PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d2uvva1:

Sequence; same for both SEQRES and ATOM records:

>d2uvva1 d.240.1.1 (A:241-342) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkireigvrfskfie

Timeline for d2uvva1:

• d2uvva1 is new in SCOP 1.73
  
• d2uvva1 appears in SCOP 1.75
  
• d2uvva1 appears in the current release, SCOPe 2.08