Lineage for d2uucq1 (2uuc Q:2-101)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1125285Protein Ribosomal protein S17 [50304] (3 species)
  7. 1125315Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 1125322Domain d2uucq1: 2uuc Q:2-101 [139968]
    Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucr1, d2uucs1, d2uuct1, d2uucu1
    automatically matched to 2J00 Q:2-101
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uucq1

PDB Entry: 2uuc (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d2uucq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uucq1 b.40.4.5 (Q:2-101) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyeslskr

SCOPe Domain Coordinates for d2uucq1:

Click to download the PDB-style file with coordinates for d2uucq1.
(The format of our PDB-style files is described here.)

Timeline for d2uucq1: