Lineage for d2uucp1 (2uuc P:1-83)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200238Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1200239Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1200240Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1200241Protein Ribosomal protein S16 [54567] (3 species)
  7. 1200271Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 1200276Domain d2uucp1: 2uuc P:1-83 [139967]
    Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1
    automatically matched to d1emwa_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uucp1

PDB Entry: 2uuc (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2uucp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uucp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d2uucp1:

Click to download the PDB-style file with coordinates for d2uucp1.
(The format of our PDB-style files is described here.)

Timeline for d2uucp1: