![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
![]() | Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) ![]() automatically mapped to Pfam PF00189 |
![]() | Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
![]() | Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries) Uniprot P80372 |
![]() | Domain d2uubc2: 2uub C:107-207 [139934] Other proteins in same PDB: d2uubb1, d2uubc1, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1 automatically matched to d1fjgc2 protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uub (more details), 2.8 Å
SCOPe Domain Sequences for d2uubc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uubc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]} qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d2uubc2: