Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S17 [50304] (3 species) |
Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries) Uniprot P24321 |
Domain d2uubq1: 2uub Q:2-101 [139948] Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubr1, d2uubs1, d2uubt1, d2uubu1 automatically matched to 2J00 Q:2-101 protein/RNA complex; complexed with k, mg, par, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2uub (more details), 2.8 Å
SCOPe Domain Sequences for d2uubq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uubq1 b.40.4.5 (Q:2-101) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]} pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie srpiskrkrfrvlrlvesgrmdlvekylirrqnyeslskr
Timeline for d2uubq1: