| Class b: All beta proteins [48724] (176 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
| Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I |
| Protein Cysteine dioxygenase type I [141616] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [141617] (2 PDB entries) Uniprot P60334 5-190 |
| Domain d2q4sa_: 2q4s A: [139877] automated match to d2atfa1 complexed with edo, ni |
PDB Entry: 2q4s (more details), 1.75 Å
SCOPe Domain Sequences for d2q4sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q4sa_ b.82.1.19 (A:) Cysteine dioxygenase type I {Mouse (Mus musculus) [TaxId: 10090]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp
Timeline for d2q4sa_: