SCOPe 2.08: Domain d2q4sa_: 2q4s A:

Lineage for d2q4sa_ (2q4s A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
   Pfam PF05995, CDO_I

6. Protein Cysteine dioxygenase type I [141616] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [141617] (2 PDB entries)
   Uniprot P60334 5-190

8. Domain d2q4sa_: 2q4s A: [139877]
   automated match to d2atfa1
   complexed with edo, ni

Details for d2q4sa_

PDB Entry: 2q4s, 1.75 Å

PDB Description: Ensemble refinement of the protein crystal structure of cysteine dioxygenase type I from Mus musculus Mm.241056

PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d2q4sa_:

Sequence; same for both SEQRES and ATOM records:

>d2q4sa_ b.82.1.19 (A:) Cysteine dioxygenase type I {Mouse (Mus musculus) [TaxId: 10090]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

Timeline for d2q4sa_:

• d2q4sa_ first appeared in SCOP 1.73, called d2q4sa1
  
• d2q4sa_ appears in SCOPe 2.07