Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I |
Protein Cysteine dioxygenase type I [141616] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141617] (2 PDB entries) Uniprot P60334 5-190 |
Domain d2atfa1: 2atf A:5-190 [127290] complexed with edo, ni |
PDB Entry: 2atf (more details), 1.75 Å
SCOPe Domain Sequences for d2atfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atfa1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Mouse (Mus musculus) [TaxId: 10090]} ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk fgirtp
Timeline for d2atfa1: