![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.129: MCP/YpsA-like [102404] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567 |
![]() | Superfamily c.129.1: MCP/YpsA-like [102405] (3 families) ![]() |
![]() | Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins) Pfam PF03641 |
![]() | Protein Hypothetical protein At5g11950 [117567] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117568] (2 PDB entries) Uniprot Q84MC2 |
![]() | Domain d2q4da_: 2q4d A: [139845] automated match to d1ydha_ complexed with edo, no3 |
PDB Entry: 2q4d (more details), 2.15 Å
SCOPe Domain Sequences for d2q4da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q4da_ c.129.1.1 (A:) Hypothetical protein At5g11950 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} qrsrfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrrvyeg glhvlgiipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpggygtmeelle mitwsqlgihkktvgllnvdgyynnllalfdtgveegfikpgarnivvsaptakelmekm eeyt
Timeline for d2q4da_: