Lineage for d2q4da_ (2q4d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922906Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2922907Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) (S)
  5. 2922908Family c.129.1.1: MoCo carrier protein-like [102406] (7 proteins)
    Pfam PF03641
  6. 2922915Protein Hypothetical protein At5g11950 [117567] (1 species)
  7. 2922916Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117568] (2 PDB entries)
    Uniprot Q84MC2
  8. 2922917Domain d2q4da_: 2q4d A: [139845]
    automated match to d1ydha_
    complexed with edo, no3

Details for d2q4da_

PDB Entry: 2q4d (more details), 2.15 Å

PDB Description: Ensemble refinement of the crystal structure of a lysine decarboxylase-like protein from Arabidopsis thaliana gene At5g11950
PDB Compounds: (A:) Lysine decarboxylase-like protein At5g11950

SCOPe Domain Sequences for d2q4da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4da_ c.129.1.1 (A:) Hypothetical protein At5g11950 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qrsrfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrrvyeg
glhvlgiipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpggygtmeelle
mitwsqlgihkktvgllnvdgyynnllalfdtgveegfikpgarnivvsaptakelmekm
eeyt

SCOPe Domain Coordinates for d2q4da_:

Click to download the PDB-style file with coordinates for d2q4da_.
(The format of our PDB-style files is described here.)

Timeline for d2q4da_: