SCOPe 2.07: Domain d2q4bb2: 2q4b B:2-253

Lineage for d2q4bb2 (2q4b B:2-253)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Hypothetical protein At5g02240 (T7H20_290) [117417] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117418] (4 PDB entries)
   Uniprot Q94EG6

8. Domain d2q4bb2: 2q4b B:2-253 [139842]
   Other proteins in same PDB: d2q4ba3, d2q4bb3
   automated match to d1xq6a_
   complexed with nap

Details for d2q4bb2

PDB Entry: 2q4b, 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of selenomethionyl gene product from Arabidopsis thaliana At5g02240 in space group P21212

PDB Compounds: (B:) Protein At5g02240

SCOPe Domain Sequences for d2q4bb2:

Sequence, based on SEQRES records:

>d2q4bb2 c.2.1.2 (B:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
anlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdad
sinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaak
vagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldke
ggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkd
fkalfsqvtsrf

Sequence, based on observed residues (ATOM records):

>d2q4bb2 c.2.1.2 (B:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
anlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdad
sinpafqgidalviltsavpkmkpefifedgqypeqvdwigqknqidaakvagvkhivvv
gsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvgk
ddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvts
rf

Timeline for d2q4bb2:

• d2q4bb2 first appeared in SCOP 1.73, called d2q4bb1
  
• d2q4bb2 appears in SCOPe 2.06
  
• d2q4bb2 appears in the current release, SCOPe 2.08