Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein Hypothetical protein At5g02240 (T7H20_290) [117417] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117418] (4 PDB entries) Uniprot Q94EG6 |
Domain d2q4bb2: 2q4b B:2-253 [139842] Other proteins in same PDB: d2q4ba3, d2q4bb3 automated match to d1xq6a_ complexed with nap |
PDB Entry: 2q4b (more details), 2.1 Å
SCOPe Domain Sequences for d2q4bb2:
Sequence, based on SEQRES records: (download)
>d2q4bb2 c.2.1.2 (B:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} anlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdad sinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaak vagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldke ggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkd fkalfsqvtsrf
>d2q4bb2 c.2.1.2 (B:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} anlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdad sinpafqgidalviltsavpkmkpefifedgqypeqvdwigqknqidaakvagvkhivvv gsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvgk ddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvts rf
Timeline for d2q4bb2: