Lineage for d2q4bb2 (2q4b B:2-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842584Protein Hypothetical protein At5g02240 (T7H20_290) [117417] (1 species)
  7. 2842585Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117418] (4 PDB entries)
    Uniprot Q94EG6
  8. 2842589Domain d2q4bb2: 2q4b B:2-253 [139842]
    Other proteins in same PDB: d2q4ba3, d2q4bb3
    automated match to d1xq6a_
    complexed with nap

Details for d2q4bb2

PDB Entry: 2q4b (more details), 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of selenomethionyl gene product from Arabidopsis thaliana At5g02240 in space group P21212
PDB Compounds: (B:) Protein At5g02240

SCOPe Domain Sequences for d2q4bb2:

Sequence, based on SEQRES records: (download)

>d2q4bb2 c.2.1.2 (B:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
anlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdad
sinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaak
vagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldke
ggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkd
fkalfsqvtsrf

Sequence, based on observed residues (ATOM records): (download)

>d2q4bb2 c.2.1.2 (B:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
anlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdad
sinpafqgidalviltsavpkmkpefifedgqypeqvdwigqknqidaakvagvkhivvv
gsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvgk
ddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvts
rf

SCOPe Domain Coordinates for d2q4bb2:

Click to download the PDB-style file with coordinates for d2q4bb2.
(The format of our PDB-style files is described here.)

Timeline for d2q4bb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q4bb3