SCOP 1.73: Domain d2pkqp2: 2pkq P:149-312

Lineage for d2pkqp2 (2pkq P:149-312)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries)

8. Domain d2pkqp2: 2pkq P:149-312 [139711]
   Other proteins in same PDB: d2pkqp1, d2pkqr1, d2pkqs1
   automatically matched to d1nboa2
   complexed with ndp, so4

Details for d2pkqp2

PDB Entry: 2pkq, 3.6 Å

PDB Description: crystal structure of the photosynthetic a2b2-glyceraldehyde-3- phosphate dehydrogenase, complexed with nadp

PDB Compounds: (P:) glyceraldehyde-3-phosphate dehydrogenase a

SCOP Domain Sequences for d2pkqp2:

Sequence; same for both SEQRES and ATOM records:

>d2pkqp2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

Timeline for d2pkqp2:

• d2pkqp2 is new in SCOP 1.73
  
• d2pkqp2 appears in SCOP 1.75
  
• d2pkqp2 appears in the current release, SCOPe 2.08