Lineage for d1nboa2 (1nbo A:149-312)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727888Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 727889Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 727890Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 727944Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 728090Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries)
  8. 728101Domain d1nboa2: 1nbo A:149-312 [85527]
    Other proteins in same PDB: d1nboa1, d1nbob1, d1nboo1

Details for d1nboa2

PDB Entry: 1nbo (more details), 2.6 Å

PDB Description: The dual coenzyme specificity of photosynthetic glyceraldehyde-3-phosphate dehydrogenase interpreted by the crystal structure of A4 isoform complexed with NAD
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase a

SCOP Domain Sequences for d1nboa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nboa2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

SCOP Domain Coordinates for d1nboa2:

Click to download the PDB-style file with coordinates for d1nboa2.
(The format of our PDB-style files is described here.)

Timeline for d1nboa2:

728101
d1nboa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1nboa1